PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09146.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 238aa    MW: 26362.1 Da    PI: 8.7478
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09146.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.11.5e-4381071100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql++el+++k+
  KHN09146.1   8 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDAVKSLAYEAEARLRDPVYGCVGLISILQHRLKQLQNELHHAKK 106
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  KHN09146.1 107 E 107
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8047108IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSSSSNSPCA ACKIQRRKCT QECVFAPYFP PDNPQRFAYV HKVFGASNVA KLLNELNAAQ  60
REDAVKSLAY EAEARLRDPV YGCVGLISIL QHRLKQLQNE LHHAKKELAS HIGSHTMLPP  120
APSLLPPEQQ PRTFSLFPFK PASTHQHDLF GFHDDGGASS ASHAGGFNNH LAAVFSPSPA  180
VDHAFSHAPM QSLTLPHHQH LMRSPMQPKP QTDPGWNTVP FFLLIPYFVI VTKLTTFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581559.11e-156PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-63LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B2PIC41e-177A0A0B2PIC4_GLYSO; LOB domain-containing protein 36
STRINGGLYMA06G11181.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-64ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]